PDB entry 1l31

View 1l31 on RCSB PDB site
Description: replacements of pro86 in phage t4 lysozyme extend an alpha-helix but do not alter protein stability
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1989-05-01, released 1990-01-15
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 lysozyme
    Species: Bacteriophage T4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • conflict (85)
    Domains in SCOP 1.73: d1l31a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l31A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkrvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl