PDB entry 1l2z

View 1l2z on RCSB PDB site
Description: CD2BP2-GYF domain in complex with proline-rich CD2 tail segment peptide
Class: peptide binding/signaling protein
Keywords: GYF domain, protein-protein interaction, proline-rich peptide, CD2, CD2BP2, PEPTIDE BINDING/SIGNALING PROTEIN COMPLEX
Deposited on 2002-02-26, released 2002-11-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cd2 antigen (cytoplasmic tail)-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CD2BP2 (amino acids 280-341)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1l2za_
  • Chain 'B':
    Compound: T-cell surface antigen cd2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l2zA (A:)
dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
yt

  • Chain 'B':
    No sequence available.