PDB entry 1l2u

View 1l2u on RCSB PDB site
Description: Orotidine 5'-monophosphate decarboxylase from E. coli
Class: lyase
Keywords: beta-alpha-barrel, homodimer, twinned crystals, X-ray diffraction, LYASE
Deposited on 2002-02-25, released 2002-03-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.162
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l2ua_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1l2ub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2uA (A:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2uA (A:)
    avtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifl
    dlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvl
    tsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpg
    irpqimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l2uB (B:)
    mtltassssravtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvre
    lqqrgfdifldlkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkd
    aplliavtvltsmeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvf
    gqefklvtpgirpqgseagdqrrimtpeqalsagvdymvigrpvtqsvdpaqtlkainas
    lqrsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2uB (B:)
    vtnspvvvaldyhnrddalafvdkidprdcrlkvgkemftlfgpqfvrelqqrgfdifld
    lkfhdipntaahavaaaadlgvwmvnvhasggarmmtaarealvpfgkdaplliavtvlt
    smeasdlvdlgmtlspadyaerlaaltqkcgldgvvcsaqeavrfkqvfgqefklvtpgi
    rpqimtpeqalsagvdymvigrpvtqsvdpaqtlkainaslqr