PDB entry 1l2r

View 1l2r on RCSB PDB site
Description: Crystal Structure of the Methanosarcina barkeri Monomethylamine Methyltransferase (MtmB)
Class: transferase
Keywords: Tim barrel
Deposited on 2002-02-24, released 2002-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2003-02-04, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.176
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monomethylamine methyltransferase
    Species: Methanosarcina barkeri
    Database cross-references and differences (RAF-indexed):
    • GB AAC38636 (Start-457)
    Domains in SCOPe 2.08: d1l2ra_
  • Heterogens: BGX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2rA (A:)
    mtfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmme
    klfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgd
    kakpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaa
    ktetrliknacamagrpgmgvkgpetslsaqgnisadctggmtctdshevsqlnelkidl
    daisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvh
    irwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasg
    reilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasap
    agktfqecydvktvtpteeymqvydgarkkledlglvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2rA (A:)
    tfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmmek
    lfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgdk
    akpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaak
    tetrliknacamagrpgmgvkgpetslsaqgnisadctggmtctdshevsqlnelkidld
    aisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvhi
    rwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasgr
    eilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasapa
    gktfqecydvktvtpteeymqvydgarkkledlglvf