PDB entry 1l2o

View 1l2o on RCSB PDB site
Description: SCALLOP MYOSIN S1-ADP-p-PDM IN THE ACTIN-DETACHED CONFORMATION
Class: contractile protein
Keywords: actin-detached, Myosin, Mechanics of MOTOR, cross linker
Deposited on 2002-02-22, released 2002-10-30
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.28
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1l2oa1, d1l2oa2
  • Chain 'B':
    Compound: myosin regulatory light chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1l2ob_
  • Chain 'C':
    Compound: myosin essential light chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1l2oc_
  • Heterogens: CA, MG, PDM, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2oA (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2oA (A:)
    fsdpdfqylavdrkklmkafdgkkncwvpdekegfasaeiqsskgdeitvkivadsstrt
    vkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyrr
    lpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentkk
    vimylakvacavkegsledqiiqanpvleaygnakttrnnnssrfgkfirihfgptgkia
    gadietylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgclt
    vdniddveefklcdeafdilgftkeekqsmfkctasilhmgemkfqaesdgtaeaekvaf
    lcginagdllkallkpkvtemvtkgqnmnqvvnsvgalakslydrmfnwlvrrvnktldt
    kakrnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqeeykkegiawe
    fidfgmdlqmcidliekpmgilsileeecmfpkaddksfqdklyqnhmgknrmftkpgkr
    pnqgpahfelhhyagnvpysitgwleknkdpinenvvallgaskeplvaelfkafqtisa
    vhreslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlrkgfpsrliy
    sefkqrysilapnaidgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderl
    skiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l2oB (B:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2oB (B:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikgsgee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l2oC (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2oC (C:)
    klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
    vdeiikltdlqedlegnvkyedfvkkvmagpyp