PDB entry 1l2n

View 1l2n on RCSB PDB site
Description: smt3 solution structure
Deposited on 2002-02-22, released 2002-03-06
The last revision prior to the SCOP 1.67 freeze date was dated 2002-06-05, with a file datestamp of 2002-06-05.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1l2na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2nA (A:)
    msdsevnqeakpevkpevkpethinlkvsdgsseiffkikkttplrrlmeafakrqgkem
    dslrflydgiriqadqtpedldmedndiieahreqiggaty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2nA (A:)
    ethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtped
    ldmedndiieahreqi