PDB entry 1l2j

View 1l2j on RCSB PDB site
Description: Human Estrogen Receptor beta Ligand-binding Domain in Complex with (R,R)-5,11-cis-diethyl-5,6,11,12-tetrahydrochrysene-2,8-diol
Class: transcription receptor
Keywords: nuclear receptor, transcription factor, estrogen, antagonist, transcription receptor
Deposited on 2002-02-21, released 2002-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.259
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l2ja_
  • Chain 'B':
    Compound: Estrogen receptor beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92731 (21-End)
      • expression tag (20)
    Domains in SCOPe 2.07: d1l2jb1, d1l2jb2
  • Heterogens: ETC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2jA (A:)
    mgsshhhhhhssglvprgshmrellldalspeqlvltlleaepphvlisrpsapfteasm
    mmsltkladkelvhmiswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgkl
    ifapdlvldrdegkcvegileifdmllattsrfrelklqhkeylcvkamillnssmyplv
    tatqdadssrklahllnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgme
    hllnmkcknvvpvydlllemlnahvlrgcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2jA (A:)
    dalspeqlvltlleaepphvlisrteasmmmsltkladkelvhmiswakkipgfvelslf
    dqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllatts
    rfrelklqhkeylcvkamillnslvtatqdadssrklahllnavtdalvwviaksgissq
    qqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlnahvlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l2jB (B:)
    mgsshhhhhhssglvprgshmrellldalspeqlvltlleaepphvlisrpsapfteasm
    mmsltkladkelvhmiswakkipgfvelslfdqvrllescwmevlmmglmwrsidhpgkl
    ifapdlvldrdegkcvegileifdmllattsrfrelklqhkeylcvkamillnssmyplv
    tatqdadssrklahllnavtdalvwviaksgissqqqsmrlanllmllshvrhasnkgme
    hllnmkcknvvpvydlllemlnahvlrgcks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2jB (B:)
    mrellldalspeqlvltlleaepphvmmmsltkladkelvhmiswakkipgfvelslfdq
    vrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmllattsrf
    relklqhkeylcvkamillnssmlvtatqdadssrklahllnavtdalvwviaksgissq
    qqsmrlanllmllshvrhasnkgmehllnmvpvydlllemlna