PDB entry 1l2f

View 1l2f on RCSB PDB site
Description: Crystal structure of NusA from Thermotoga maritima: a structure-based role of the N-terminal domain
Class: transcription
Keywords: NusA, Crystal structure, OB fold KH domain, RNA polymerase, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, TRANSCRIPTION
Deposited on 2002-02-20, released 2003-09-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n utilization substance protein a
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X298 (Start-368)
      • modified residue (25)
      • modified residue (170)
      • modified residue (232)
      • modified residue (366)
    Domains in SCOPe 2.06: d1l2fa1, d1l2fa2, d1l2fa3, d1l2fa4
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2fA (A:)
    mgsshhhhhhnynipttenlyfqghmnigllealdqleeekgiskeevipilekalvsay
    rknfgnsknvevvidrntgnikvyqllevveevedpatqisleeakkidplaevgsivkk
    elnvknfgriaaqtakqvliqrirelekekqfekyselkgtvttaevirvmgewadirig
    kletrlpkkewipgeeikagdlvkvyiidvvkttkgpkilvsrrvpefviglmkleipev
    engiveikaiarepgvrtkvavasndpnvdpigacigeggsriaailkelkgekldvlkw
    sddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwk
    idikpimnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2fA (A:)
    mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyq
    llevveevedpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrire
    lekekqfekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkv
    yiidvvkttkgpkilvsrrvpefviglmkleipevengiveikaiarepgvrtkvavasn
    dpnvdpigacigeggsriaailkelkgekldvlkwsddpkqlianalapatvieveildk
    enkaarvlvpptqlslaigkggqnarlaakltgwkidikpimnl