PDB entry 1l2d

View 1l2d on RCSB PDB site
Description: MutM (Fpg)-DNA Estranged Guanine Mismatch Recognition Complex
Class: hydrolase/DNA
Keywords: DNA Repair, DNA glycosylase, zinc finger
Deposited on 2002-02-20, released 2002-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2002-06-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MutM
    Species: Bacillus stearothermophilus
    Gene: mutM
    Domains in SCOP 1.73: d1l2da1, d1l2da2, d1l2da3
  • Chain 'B':
    Compound: 5'-d(*ap*g*gp*tp*ap*gp*ap*cp*gp*tp*gp*gp*ap*cp*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(*tp*gp*c*gp*tp*cp*cp*ap*(hpd)p*gp*tp*cp*tp*ap*cp*c)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2dA (A:)
    mpelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgk
    flkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvy
    akeeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdes
    lfragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhly
    vygrqgnpckrcgtpiektvvagrgthycprcqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2dA (A:)
    pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmkggsfqhhlyvygrqgnpckrcgtp
    iektvvagrgthycprcqr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.