PDB entry 1l2c

View 1l2c on RCSB PDB site
Description: MutM (Fpg)-DNA Estranged Thymine Mismatch Recognition Complex
Deposited on 2002-02-20, released 2002-06-14
The last revision prior to the SCOP 1.65 freeze date was dated 2002-06-21, with a file datestamp of 2002-06-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2cA (A:)
    mpelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgk
    flkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvy
    akeeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdes
    lfragilpgrpaaslsskeierlheemvatigeavmkggstvrtyvntqgeagtfqhhly
    vygrqgnpckrcgtpiektvvagrgthycprcqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2cA (A:)
    pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
    lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
    keeadrrpplaelgpeplspafspavlaeravktkrsvkallldqtvvagfgniyvdesl
    fragilpgrpaaslsskeierlheemvatigeavmkggsfqhhlyvygrqgnpckrcgtp
    iektvvagrgthycprcqr