PDB entry 1l2a

View 1l2a on RCSB PDB site
Description: The Crystal Structure and Catalytic Mechanism of Cellobiohydrolase CelS, the Major Enzymatic Component of the Clostridium thermocellum cellulosome
Class: hydrolase
Keywords: alpha/alpha barrel, hydrolase
Deposited on 2002-02-20, released 2002-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellobiohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: cels
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l2aa_
  • Chain 'B':
    Compound: cellobiohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: cels
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l2ab_
  • Chain 'C':
    Compound: cellobiohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: cels
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l2ac_
  • Chain 'D':
    Compound: cellobiohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: cels
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l2ad_
  • Chain 'E':
    Compound: cellobiohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: cels
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l2ae_
  • Chain 'F':
    Compound: cellobiohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Gene: cels
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l2af_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l2aA (A:)
    mvksrkisillavamlvsimipttafagptkaptkdgtsykdlflelygkikdpkngyfs
    pdegipyhsietliveapdyghvttseafsyyvwleamygnltgnwsgvetawkvmedwi
    ipdsteqpgmssynpnspatyadeyedpsyypselkfdtvrvgsdpvhndlvsaygpnmy
    lmhwlmdvdnwygfgtgtratfintfqrgeqestwetiphpsieefkyggpngfldlftk
    drsyakqwrytnapdaegraiqavywankwakeqgkgsavasvvskaakmgdflrndmfd
    kyfmkigaqdktpatgydsahylmawytawgggigaswawkigcshahfgyqnpfqgwvs
    atqsdfapkssngkrdwttsykrqlefyqwlqsaeggiaggatnswngryekypagtstf
    ygmayvphpvyadpgsnqwfgfqawsmqrvmeyyletgdssvknlikkwvdwvmseikly
    ddgtfaipsdlewsgqpdtwtgtytgnpnlhvrvtsygtdlgvagslanalatyaaater
    wegkldtkardmaaelvnrawynfycsegkgvvteearadykrffeqevyvpagwsgtmp
    ngdkiqpgikfidirtkyrqdpyydivyqaylrgeapvlnyhrfwhevdlavamgvlaty
    fpdmtykvpgtpstklyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2aA (A:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l2aB (B:)
    mvksrkisillavamlvsimipttafagptkaptkdgtsykdlflelygkikdpkngyfs
    pdegipyhsietliveapdyghvttseafsyyvwleamygnltgnwsgvetawkvmedwi
    ipdsteqpgmssynpnspatyadeyedpsyypselkfdtvrvgsdpvhndlvsaygpnmy
    lmhwlmdvdnwygfgtgtratfintfqrgeqestwetiphpsieefkyggpngfldlftk
    drsyakqwrytnapdaegraiqavywankwakeqgkgsavasvvskaakmgdflrndmfd
    kyfmkigaqdktpatgydsahylmawytawgggigaswawkigcshahfgyqnpfqgwvs
    atqsdfapkssngkrdwttsykrqlefyqwlqsaeggiaggatnswngryekypagtstf
    ygmayvphpvyadpgsnqwfgfqawsmqrvmeyyletgdssvknlikkwvdwvmseikly
    ddgtfaipsdlewsgqpdtwtgtytgnpnlhvrvtsygtdlgvagslanalatyaaater
    wegkldtkardmaaelvnrawynfycsegkgvvteearadykrffeqevyvpagwsgtmp
    ngdkiqpgikfidirtkyrqdpyydivyqaylrgeapvlnyhrfwhevdlavamgvlaty
    fpdmtykvpgtpstklyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2aB (B:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l2aC (C:)
    mvksrkisillavamlvsimipttafagptkaptkdgtsykdlflelygkikdpkngyfs
    pdegipyhsietliveapdyghvttseafsyyvwleamygnltgnwsgvetawkvmedwi
    ipdsteqpgmssynpnspatyadeyedpsyypselkfdtvrvgsdpvhndlvsaygpnmy
    lmhwlmdvdnwygfgtgtratfintfqrgeqestwetiphpsieefkyggpngfldlftk
    drsyakqwrytnapdaegraiqavywankwakeqgkgsavasvvskaakmgdflrndmfd
    kyfmkigaqdktpatgydsahylmawytawgggigaswawkigcshahfgyqnpfqgwvs
    atqsdfapkssngkrdwttsykrqlefyqwlqsaeggiaggatnswngryekypagtstf
    ygmayvphpvyadpgsnqwfgfqawsmqrvmeyyletgdssvknlikkwvdwvmseikly
    ddgtfaipsdlewsgqpdtwtgtytgnpnlhvrvtsygtdlgvagslanalatyaaater
    wegkldtkardmaaelvnrawynfycsegkgvvteearadykrffeqevyvpagwsgtmp
    ngdkiqpgikfidirtkyrqdpyydivyqaylrgeapvlnyhrfwhevdlavamgvlaty
    fpdmtykvpgtpstklyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2aC (C:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l2aD (D:)
    mvksrkisillavamlvsimipttafagptkaptkdgtsykdlflelygkikdpkngyfs
    pdegipyhsietliveapdyghvttseafsyyvwleamygnltgnwsgvetawkvmedwi
    ipdsteqpgmssynpnspatyadeyedpsyypselkfdtvrvgsdpvhndlvsaygpnmy
    lmhwlmdvdnwygfgtgtratfintfqrgeqestwetiphpsieefkyggpngfldlftk
    drsyakqwrytnapdaegraiqavywankwakeqgkgsavasvvskaakmgdflrndmfd
    kyfmkigaqdktpatgydsahylmawytawgggigaswawkigcshahfgyqnpfqgwvs
    atqsdfapkssngkrdwttsykrqlefyqwlqsaeggiaggatnswngryekypagtstf
    ygmayvphpvyadpgsnqwfgfqawsmqrvmeyyletgdssvknlikkwvdwvmseikly
    ddgtfaipsdlewsgqpdtwtgtytgnpnlhvrvtsygtdlgvagslanalatyaaater
    wegkldtkardmaaelvnrawynfycsegkgvvteearadykrffeqevyvpagwsgtmp
    ngdkiqpgikfidirtkyrqdpyydivyqaylrgeapvlnyhrfwhevdlavamgvlaty
    fpdmtykvpgtpstklyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2aD (D:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l2aE (E:)
    mvksrkisillavamlvsimipttafagptkaptkdgtsykdlflelygkikdpkngyfs
    pdegipyhsietliveapdyghvttseafsyyvwleamygnltgnwsgvetawkvmedwi
    ipdsteqpgmssynpnspatyadeyedpsyypselkfdtvrvgsdpvhndlvsaygpnmy
    lmhwlmdvdnwygfgtgtratfintfqrgeqestwetiphpsieefkyggpngfldlftk
    drsyakqwrytnapdaegraiqavywankwakeqgkgsavasvvskaakmgdflrndmfd
    kyfmkigaqdktpatgydsahylmawytawgggigaswawkigcshahfgyqnpfqgwvs
    atqsdfapkssngkrdwttsykrqlefyqwlqsaeggiaggatnswngryekypagtstf
    ygmayvphpvyadpgsnqwfgfqawsmqrvmeyyletgdssvknlikkwvdwvmseikly
    ddgtfaipsdlewsgqpdtwtgtytgnpnlhvrvtsygtdlgvagslanalatyaaater
    wegkldtkardmaaelvnrawynfycsegkgvvteearadykrffeqevyvpagwsgtmp
    ngdkiqpgikfidirtkyrqdpyydivyqaylrgeapvlnyhrfwhevdlavamgvlaty
    fpdmtykvpgtpstklyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2aE (E:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1l2aF (F:)
    mvksrkisillavamlvsimipttafagptkaptkdgtsykdlflelygkikdpkngyfs
    pdegipyhsietliveapdyghvttseafsyyvwleamygnltgnwsgvetawkvmedwi
    ipdsteqpgmssynpnspatyadeyedpsyypselkfdtvrvgsdpvhndlvsaygpnmy
    lmhwlmdvdnwygfgtgtratfintfqrgeqestwetiphpsieefkyggpngfldlftk
    drsyakqwrytnapdaegraiqavywankwakeqgkgsavasvvskaakmgdflrndmfd
    kyfmkigaqdktpatgydsahylmawytawgggigaswawkigcshahfgyqnpfqgwvs
    atqsdfapkssngkrdwttsykrqlefyqwlqsaeggiaggatnswngryekypagtstf
    ygmayvphpvyadpgsnqwfgfqawsmqrvmeyyletgdssvknlikkwvdwvmseikly
    ddgtfaipsdlewsgqpdtwtgtytgnpnlhvrvtsygtdlgvagslanalatyaaater
    wegkldtkardmaaelvnrawynfycsegkgvvteearadykrffeqevyvpagwsgtmp
    ngdkiqpgikfidirtkyrqdpyydivyqaylrgeapvlnyhrfwhevdlavamgvlaty
    fpdmtykvpgtpstklyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l2aF (F:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp