PDB entry 1l2a

View 1l2a on RCSB PDB site
Description: the crystal structure and catalytic mechanism of cellobiohydrolase cels, the major enzymatic component of the clostridium thermocellum cellulosome
Deposited on 2002-02-20, released 2002-07-17
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-17, with a file datestamp of 2002-07-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1l2aa_
  • Chain 'B':
    Domains in SCOP 1.61: d1l2ab_
  • Chain 'C':
    Domains in SCOP 1.61: d1l2ac_
  • Chain 'D':
    Domains in SCOP 1.61: d1l2ad_
  • Chain 'E':
    Domains in SCOP 1.61: d1l2ae_
  • Chain 'F':
    Domains in SCOP 1.61: d1l2af_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l2aA (A:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l2aB (B:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l2aC (C:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l2aD (D:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l2aE (E:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l2aF (F:)
    gptkaptkdgtsykdlflelygkikdpkngyfspdegipyhsietliveapdyghvttse
    afsyyvwleamygnltgnwsgvetawkvmedwiipdsteqpgmssynpnspatyadeyed
    psyypselkfdtvrvgsdpvhndlvsaygpnmylmhwlmdvdnwygfgtgtratfintfq
    rgeqestwetiphpsieefkyggpngfldlftkdrsyakqwrytnapdaegraiqavywa
    nkwakeqgkgsavasvvskaakmgdflrndmfdkyfmkigaqdktpatgydsahylmawy
    tawgggigaswawkigcshahfgyqnpfqgwvsatqsdfapkssngkrdwttsykrqlef
    yqwlqsaeggiaggatnswngryekypagtstfygmayvphpvyadpgsnqwfgfqawsm
    qrvmeyyletgdssvknlikkwvdwvmseiklyddgtfaipsdlewsgqpdtwtgtytgn
    pnlhvrvtsygtdlgvagslanalatyaaaterwegkldtkardmaaelvnrawynfycs
    egkgvvteearadykrffeqevyvpagwsgtmpngdkiqpgikfidirtkyrqdpyydiv
    yqaylrgeapvlnyhrfwhevdlavamgvlatyfpdmtykvp