PDB entry 1l21

View 1l21 on RCSB PDB site
Description: contributions of left-handed helical residues to the structure and stability of bacteriophage t4 lysozyme
Deposited on 1989-05-01, released 1990-01-15
The last revision prior to the SCOP 1.57 freeze date was dated 1990-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.85 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1l21__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l21_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncggvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl