PDB entry 1l1p

View 1l1p on RCSB PDB site
Description: solution structure of the ppiase domain from e. coli trigger factor
Deposited on 2002-02-19, released 2003-06-24
The last revision prior to the SCOP 1.71 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1l1pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l1pA (A:)
    gshmqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgqgrmipgfedgik
    ghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpelt