PDB entry 1l1o

View 1l1o on RCSB PDB site
Description: Structure of the human Replication Protein A (RPA) trimerization core
Class: DNA binding protein
Keywords: eukaryotic SSB, ssDNA binding protein, OB-fold
Deposited on 2002-02-19, released 2002-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication protein A 14 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RFA3_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1oa_
  • Chain 'B':
    Compound: Replication protein A 32 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RFA2_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1ob_
  • Chain 'C':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RFA1_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1oc_
  • Chain 'D':
    Compound: Replication protein A 14 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RFA3_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1od_
  • Chain 'E':
    Compound: Replication protein A 32 kDa subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RFA2_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1oe_
  • Chain 'F':
    Compound: Replication protein A 70 kDa DNA-binding subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: RFA1_HUMAN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1of_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l1oA (A:)
    mvdmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepld
    eeisgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgivqh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1oA (A:)
    dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
    isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l1oB (B:)
    qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
    vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
    nahmvlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1oB (B:)
    qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
    vrqwvdtdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmv
    lsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l1oC (C:)
    ggsntnwktlyevksenlgqgdkpdyfssvatvvylrkencmyqacptqdcnkkvidqqn
    glyrcekcdtefpnfkyrmilsvniadfqenqwvtcfqesaeailgqnaaylgelkdkne
    qafeevfqnanfrsfifrvrvkvetyndesrikatvmdvkpvdyreygrrlvmsirrsal
    m
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1oC (C:)
    ntnwktlyevksenlgqgdkpdyfssvatvvylrkencmyqacptqdcnkkvidqqngly
    rcekcdtefpnfkyrmilsvniadfqenqwvtcfqesaeailgqnaaylgelkdkneqaf
    eevfqnanfrsfifrvrvkvetyikatvmdvkpvdyreygrrlvmsirrsalm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1l1oD (D:)
    mvdmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepld
    eeisgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgivqh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1oD (D:)
    dmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepldee
    isgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1l1oE (E:)
    qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
    vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
    nahmvlsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1oE (E:)
    qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
    vrqwvdtdntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmv
    lsk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1l1oF (F:)
    ggsntnwktlyevksenlgqgdkpdyfssvatvvylrkencmyqacptqdcnkkvidqqn
    glyrcekcdtefpnfkyrmilsvniadfqenqwvtcfqesaeailgqnaaylgelkdkne
    qafeevfqnanfrsfifrvrvkvetyndesrikatvmdvkpvdyreygrrlvmsirrsal
    m
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1oF (F:)
    ntnwktlyevksenlgqgdkpdyfssvatvvylrkencmyqacptqdcnkkvidqqngly
    rcekcdtefpnfkyrmilsvniadfqenqwvtcfqesaeailgqnaaylgelkdkneqaf
    eevfqnanfrsfifrvrvkveikatvmdvkpvdyreygrrlvmsirrsalm