PDB entry 1l1n

View 1l1n on RCSB PDB site
Description: poliovirus 3c proteinase
Class: Viral protein, hydrolase
Keywords: BETA BARREL, TRYPSIN-LIKE, CATALYTIC TRIAD, Viral protein, hydrolase
Deposited on 2002-02-19, released 2002-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein: Picornain 3C
    Species: Poliovirus [TaxId:12081]
    Gene: 3C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1na_
  • Chain 'B':
    Compound: Genome polyprotein: Picornain 3C
    Species: Poliovirus [TaxId:12081]
    Gene: 3C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l1nb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l1nA (A:)
    gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkeveildak
    aledqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
    eqgylnlggrqtartlmynfptragqcggvitctgkvigmhvggngshgfaaalkrsyft
    qsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1nA (A:)
    gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkeveildak
    aledqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
    eqgylnlggrqtartlmynfptragqcggvitctgkvigmhvggngshgfaaalkrsyft
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l1nB (B:)
    gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkeveildak
    aledqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
    eqgylnlggrqtartlmynfptragqcggvitctgkvigmhvggngshgfaaalkrsyft
    qsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l1nB (B:)
    gfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkeveildakal
    edqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavteq
    gylnlggrqtartlmynfptragqcggvitctgkvigmhvggngshgfaaalkrsyft