PDB entry 1l19

View 1l19 on RCSB PDB site
Description: enhanced protein thermostability from designed mutations that interact with alpha-helix dipoles
Deposited on 1989-05-01, released 1990-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1990-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.153
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1l19__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l19_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspdlnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl