PDB entry 1l12

View 1l12 on RCSB PDB site
Description: contributions of hydrogen bonds of thr 157 to the thermodynamic stability of phage t4 lysozyme
Deposited on 1988-02-05, released 1988-04-16
The last revision prior to the SCOP 1.59 freeze date was dated 1988-04-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1l12__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1l12_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgnwdayknl