PDB entry 1l0y

View 1l0y on RCSB PDB site
Description: T cell receptor beta chain complexed with superantigen SpeA soaked with zinc
Class: immune system
Keywords: TCR, superantigen, SpeA
Deposited on 2002-02-14, released 2002-04-03
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14.3.d T cell receptor beta chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01851 (0-235)
      • engineered (21)
      • engineered (70)
      • see remark 999 (95-97)
      • engineered (116)
    Domains in SCOP 1.73: d1l0ya1, d1l0ya2
  • Chain 'B':
    Compound: exotoxin type a
    Species: Streptococcus pyogenes
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08095 (0-End)
      • engineered (89)
    Domains in SCOP 1.73: d1l0yb1, d1l0yb2
  • Chain 'C':
    Compound: 14.3.d T cell receptor beta chain
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01851 (0-235)
      • engineered (21)
      • engineered (70)
      • see remark 999 (95-97)
      • engineered (116)
    Domains in SCOP 1.73: d1l0yc1, d1l0yc2
  • Chain 'D':
    Compound: exotoxin type a
    Species: Streptococcus pyogenes
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08095 (0-220)
      • engineered (89)
    Domains in SCOP 1.73: d1l0yd1, d1l0yd2
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0yA (A:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l0yB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0yB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0yC (C:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0yD (D:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk