PDB entry 1l0y

View 1l0y on RCSB PDB site
Description:
Deposited on 2002-02-14, released 2002-04-03
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-03, with a file datestamp of 2002-04-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1l0ya1, d1l0ya2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1l0yb1, d1l0yb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1l0yc1, d1l0yc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1l0yd1, d1l0yd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0yA (A:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0yB (B:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievyltt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0yC (C:)
    avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvledlrqvtp
    pkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesny
    syclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0yD (D:)
    qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
    elknqematlfkdknvdiygveyyhlcylsenaersaciyggvtnhegnhleipkkivvk
    vsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpskyetgyikfipknke
    sfwfdffpepeftqskylmiykdnetldsntsqievylttk