PDB entry 1l0w

View 1l0w on RCSB PDB site
Description: Aspartyl-tRNA synthetase-1 from space-grown crystals
Class: ligase
Keywords: Space-grown crystal, dimeric enzyme, flexible domains, LIGASE
Deposited on 2002-02-14, released 2002-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1l0wa1, d1l0wa2, d1l0wa3
  • Chain 'B':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1l0wb1, d1l0wb2, d1l0wb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0wA (A:)
    mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
    ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeaktppfpvdagwrgeeek
    easeelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfvqvetpfltkstpegar
    dflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrdedlradrqpdftqldl
    emsfvevedvlelnerlmahvfrealgvelplpfprlsyeeamerygsdkpdlrfglelk
    evgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarveeggfs
    ggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglkregfrf
    lwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrvralaydlvlngvevggg
    sirihdprlqarvfrllgigeeeqrekfgfflealeygapphggiawgldrllalmtgsp
    sireviafpknkegkdpltgapspvpeeqlrelglmvvrp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0wB (B:)
    mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
    ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeaktppfpvdagwrgeeek
    easeelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfvqvetpfltkstpegar
    dflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrdedlradrqpdftqldl
    emsfvevedvlelnerlmahvfrealgvelplpfprlsyeeamerygsdkpdlrfglelk
    evgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarveeggfs
    ggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglkregfrf
    lwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrvralaydlvlngvevggg
    sirihdprlqarvfrllgigeeeqrekfgfflealeygapphggiawgldrllalmtgsp
    sireviafpknkegkdpltgapspvpeeqlrelglmvvrp