PDB entry 1l0v

View 1l0v on RCSB PDB site
Description: Quinol-Fumarate Reductase with Menaquinol Molecules
Class: oxidoreductase
Keywords: fumarate reductase, succinate dehydrogenase, complex II, quinol, membrane protein
Deposited on 2002-02-13, released 2002-03-13
The last revision prior to the SCOP 1.73 freeze date was dated 2002-08-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.245
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Escherichia coli
    Gene: FrdA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l0va1, d1l0va2, d1l0va3
  • Chain 'B':
    Compound: fumarate reductase iron-sulfur protein
    Species: Escherichia coli
    Gene: frdB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l0vb1, d1l0vb2
  • Chain 'C':
    Compound: fumarate reductase 15 kda hydrophobic protein
    Species: Escherichia coli
    Gene: frdC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l0vc_
  • Chain 'D':
    Compound: fumarate reductase 13 kda hydrophobic protein
    Species: Escherichia coli
    Gene: frdD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l0vd_
  • Chain 'M':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Escherichia coli
    Gene: FrdA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l0vm1, d1l0vm2, d1l0vm3
  • Chain 'N':
    Compound: fumarate reductase iron-sulfur protein
    Species: Escherichia coli
    Gene: frdB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l0vn1, d1l0vn2
  • Chain 'O':
    Compound: fumarate reductase 15 kda hydrophobic protein
    Species: Escherichia coli
    Gene: frdC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l0vo_
  • Chain 'P':
    Compound: fumarate reductase 13 kda hydrophobic protein
    Species: Escherichia coli
    Gene: frdD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1l0vp_
  • Heterogens: OAA, FES, F3S, SF4, FAD, MQ7, CE1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l0vA (A:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppakrvyggeadaadkaeaankkeka
    ng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0vA (A:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vB (B:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vC (C:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vD (D:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1l0vM (M:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppakrvyggeadaadkaeaankkeka
    ng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0vM (M:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaeggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppa
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vN (N:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vO (O:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0vP (P:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti