PDB entry 1l0p

View 1l0p on RCSB PDB site
Description: crystal structure analysis of the complex between psychrophilic alpha amylase from pseudoalteromonas haloplanctis and nitrate
Class: hydrolase
Keywords: beta-alpha-8-barrel, 3 domain structure, hydrolase
Deposited on 2002-02-12, released 2002-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.146
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1l0pa1, d1l0pa2
  • Heterogens: CA, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0pA (A:)
    tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
    ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
    tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
    asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
    lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
    vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntadnwavtn
    wwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadakscsgev
    itvnsdgtinlnigawdamaihknakln