PDB entry 1l0i

View 1l0i on RCSB PDB site
Description: crystal structure of butyryl-acp i62m mutant
Deposited on 2002-02-11, released 2003-02-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-11, with a file datestamp of 2003-02-11.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.16
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1l0ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l0iA (A:)
    mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
    ekmttvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0iA (A:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kmttvqaaidyinghqa