PDB entry 1l0i

View 1l0i on RCSB PDB site
Description: Crystal structure of butyryl-ACP I62M mutant
Class: lipid transport
Keywords: acyl carrier protein, acyl chain binding, fatty acid biosynthesis, LIPID TRANSPORT
Deposited on 2002-02-11, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6A8 (Start-77)
      • engineered (62)
    Domains in SCOPe 2.07: d1l0ia_
  • Heterogens: NA, ZN, CAC, PSR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l0iA (A:)
    mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
    ekmttvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0iA (A:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kmttvqaaidyinghqa