PDB entry 1l0h

View 1l0h on RCSB PDB site
Description: crystal structure of butyryl-acp from e.coli
Class: lipid transport
Keywords: acyl carrier protein, acyl chain binding, crystal structure, fatty acid biosynthesis, LIPID TRANSPORT
Deposited on 2002-02-11, released 2003-02-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6A8 (1-76)
  Domains in SCOPe 2.03: d1l0ha_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1l0hA (A:)
  mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
  ekittvqaaidyinghqa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1l0hA (A:)
  stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
  kittvqaaidyinghq