PDB entry 1l0h

View 1l0h on RCSB PDB site
Description: crystal structure of butyryl-acp from e.coli
Class: lipid transport
Keywords: acyl carrier protein, acyl chain binding, crystal structure, fatty acid biosynthesis, LIPID TRANSPORT
Deposited on 2002-02-11, released 2003-02-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1l0ha_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l0hA (A:)
    mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
    ekittvqaaidyinghqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0hA (A:)
    stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
    kittvqaaidyinghq