PDB entry 1l0h

View 1l0h on RCSB PDB site
Description: crystal structure of butyryl-acp from e.coli
Deposited on 2002-02-11, released 2003-02-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1l0ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1l0hA (A:)
mstieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeea
ekittvqaaidyinghqa

    Sequence, based on observed residues (ATOM records): (download) 
    >1l0hA (A:)
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghq