PDB entry 1l0c

View 1l0c on RCSB PDB site
Description: Investigation of the Roles of Catalytic Residues in Serotonin N-Acetyltransferase
Class: transferase
Keywords: Enzyme-inhibitor complex, bisubstrate analog, alternate conformations, TRANSFERASE
Deposited on 2002-02-08, released 2002-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serotonin n-acetyltransferase
    Species: Ovis aries [TaxId:9940]
    Gene: AANAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29495
      • engineered (167)
    Domains in SCOPe 2.06: d1l0ca_
  • Heterogens: COT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l0cA (A:)
    mstpsvhclkpsplhlpsgipgspgrqrrhtlpanefrcltpedaagvfeiereafisvs
    gncplnldevqhfltlcpelslgwfvegrlvafiigslwdeerltqeslalhrprghsah
    lhalavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalvpffqrfgfhpagpca
    ivvgsltftemhcslrghaalrrnsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l0cA (A:)
    htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
    lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
    qpavrravlmcedalvpffqrfgfhpagpcaivvgsltftemhcsl