PDB entry 1l0c

View 1l0c on RCSB PDB site
Description: investigation of the roles of catalytic residues in serotonin n- acetyltransferase
Deposited on 2002-02-08, released 2002-06-19
The last revision prior to the SCOP 1.63 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1l0ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l0cA (A:)
    htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
    lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
    qpavrravlmcedalvpffqrfgfhpagpcaivvgsltftemhcsl