PDB entry 1l01

View 1l01 on RCSB PDB site
Description: structural studies of mutants of the lysozyme of bacteriophage t4. the temperature-sensitive mutant protein thr157 (right arrow) ile
Deposited on 1988-02-05, released 1988-04-16
The last revision prior to the SCOP 1.55 freeze date was dated 1988-04-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1l01__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1l01_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfragiwdayknl