PDB entry 1kzl

View 1kzl on RCSB PDB site
Description: Riboflavin Synthase from S.pombe bound to Carboxyethyllumazine
Class: transferase
Keywords: biosynthesis of riboflavin, riboflavin synthase, X-ray structure, Schizosaccharomyces pombe, ligand binding, TRANSFERASE
Deposited on 2002-02-07, released 2002-11-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: riboflavin synthase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1kzla1, d1kzla2
  • Heterogens: HG, CRM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kzlA (A:)
    mftglveaigvvkdvqgtidngfamkieapqilddchtgdsiavngtcltvtdfdryhft
    vgiapeslrltnlgqckagdpvnleravlsstrmgghfvqghvdtvaeivekkqdgeaid
    ftfrprdpfvlkyivykgyialdgtsltithvddstfsimmisytqskvimakknvgdlv
    nvevdqigkyteklveahiadwikktqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kzlA (A:)
    mftglveaigvvkdvqgtidngfamkieapqilddchtgdsiavngtcltvtdfdryhft
    vgiapeslrltnlgqckagdpvnleravlsstrmgghfvqghvdtvaeivekkqdgeaid
    ftfrprdpfvlkyivykgyialdgtsltithvddstfsimmisytqskvimakknvgdlv
    nvevdqigkyteklveahiadw