PDB entry 1kzk

View 1kzk on RCSB PDB site
Description: JE-2147-HIV Protease Complex
Class: Viral protein, hydrolase
Keywords: HIV Protease Complex, Anisotropic Displacement Parameters
Deposited on 2002-02-06, released 2002-04-03
The last revision prior to the SCOP 1.75 freeze date was dated 2002-04-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.152
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
  Domains in SCOP 1.75: d1kzka_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
  Domains in SCOP 1.75: d1kzkb_
• Heterogens: JE2, CL, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kzkA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kzkB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf