PDB entry 1kzh

View 1kzh on RCSB PDB site
Description: structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
Deposited on 2002-02-06, released 2002-05-15
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-15, with a file datestamp of 2002-05-15.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.203
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kzha_
  • Chain 'B':
    Domains in SCOP 1.61: d1kzhb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kzhA (A:)
    slfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfteg
    esslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendki
    elteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntnaa
    ilaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstkk
    ywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslngd
    nfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgvy
    lslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpvd
    hffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvplt
    mlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseivd
    eitetlklel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kzhB (B:)
    tslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfte
    gesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendk
    ielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntna
    ailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstk
    kywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslng
    dnfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgv
    ylslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpv
    dhffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvpl
    tmlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseiv
    deitetlklel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kzhB (B:)
    tslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfte
    gesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendk
    ielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntna
    ailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstk
    kywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslng
    dnfgvvivpegliefipevkslmlelcdifiekmkeifvaklsdymkgvylslplfiqfe
    liksilervpteklfiemiqsrlndmkkrgeykgsftpvdhffgyegrsafpsnfdsdyc
    yslgynavvlilngltgymsciknlnlkptdwiaggvpltmlmnmeerygekkpvikkal
    vdlegrpfkefvknrdkwalnnlylypgpvqyfgsseivdeitetlklel