PDB entry 1kzh

View 1kzh on RCSB PDB site
Description: Structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi
Class: transferase
Keywords: phosphofructokinase, pyrophosphate, phosphotransferase, spirochete, borrelia burgdorferi, TRANSFERASE
Deposited on 2002-02-06, released 2002-05-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphofructokinase
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: BB0020
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kzha_
  • Chain 'B':
    Compound: phosphofructokinase
    Species: Borrelia burgdorferi [TaxId:139]
    Gene: BB0020
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kzhb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kzhA (A:)
    mntslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisf
    tegesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllen
    dkielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsnt
    naailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdams
    tkkywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrsl
    ngdnfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymk
    gvylslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsft
    pvdhffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggv
    pltmlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsse
    ivdeitetlklelfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kzhA (A:)
    slfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfteg
    esslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendki
    elteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntnaa
    ilaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstkk
    ywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslngd
    nfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgvy
    lslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpvd
    hffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvplt
    mlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseivd
    eitetlklel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kzhB (B:)
    mntslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisf
    tegesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllen
    dkielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsnt
    naailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdams
    tkkywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrsl
    ngdnfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymk
    gvylslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsft
    pvdhffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggv
    pltmlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsse
    ivdeitetlklelfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kzhB (B:)
    tslfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfte
    gesslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendk
    ielteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntna
    ailaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstk
    kywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslng
    dnfgvvivpegliefipevkslmlelcdifiekmkeifvaklsdymkgvylslplfiqfe
    liksilervpteklfiemiqsrlndmkkrgeykgsftpvdhffgyegrsafpsnfdsdyc
    yslgynavvlilngltgymsciknlnlkptdwiaggvpltmlmnmeerygekkpvikkal
    vdlegrpfkefvknrdkwalnnlylypgpvqyfgsseivdeitetlklel