PDB entry 1kzg

View 1kzg on RCSB PDB site
Description: DbsCdc42(Y889F)
Class: signaling protein
Keywords: guanine nucleotide exchange factor, small G-protein, Cdc42, Dbs, DH/PH, SIGNALING PROTEIN
Deposited on 2002-02-06, released 2002-03-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide exchange factor dbs
    Species: Mus musculus [TaxId:10090]
    Gene: Dbs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64096
      • see remark 999 (74-79)
      • engineered (267)
    Domains in SCOPe 2.01: d1kzga1, d1kzga2
  • Chain 'B':
    Compound: cdc42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953
      • engineered (187)
    Domains in SCOPe 2.01: d1kzgb_
  • Chain 'C':
    Compound: guanine nucleotide exchange factor dbs
    Species: Mus musculus [TaxId:10090]
    Gene: Dbs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64096
      • see remark 999 (74-79)
      • engineered (267)
    Domains in SCOPe 2.01: d1kzgc1, d1kzgc2
  • Chain 'D':
    Compound: cdc42 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1kzgd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kzgA (A:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsfsykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kzgA (A:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkgelarfkpmqrhlflhek
    avlfckkreengegyekapsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqa
    ptpeikaawvneirkvltsqlqacreasqhraleqsh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kzgB (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kzgC (C:)
    mgeeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkkni
    lfgnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrq
    csdcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealss
    ilgilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqr
    hlflhekavlfckkreengegyekapsfsykqslnmtavgitenvkgdtkkfeiwynare
    evyiiqaptpeikaawvneirkvltsqlqacreasqhraleqshslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kzgC (C:)
    eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
    gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
    dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
    gilkavndsmhliaitgydgnlgdlgkllmqgsfsvwtdhkelarfkpmqrhlflhekav
    lfckkreengegyekapsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqapt
    peikaawvneirkvltsqlqacreasqhra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kzgD (D:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
    epkksrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kzgD (D:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal