PDB entry 1kyy

View 1kyy on RCSB PDB site
Description: Lumazine Synthase from S.pombe bound to nitropyrimidinedione
Class: transferase
Keywords: riboflavin biosynthesis, lumazine synthase, Schizosaccharomyces pombe, ligand binding, TRANSFERASE
Deposited on 2002-02-06, released 2002-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyya_
  • Chain 'B':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyyb_
  • Chain 'C':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyyc_
  • Chain 'D':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyyd_
  • Chain 'E':
    Compound: 6,7-dimethyl-8-ribityllumazine synthase
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyye_
  • Heterogens: PO4, INI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kyyA (A:)
    mfsgikgpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvp
    gswelpqgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilg
    lltvlneeqalyraglngghnhgndwgsaavemglkaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyyA (A:)
    psdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgi
    rasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeq
    alyraglngghnhgndwgsaavemglkal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kyyB (B:)
    mfsgikgpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvp
    gswelpqgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilg
    lltvlneeqalyraglngghnhgndwgsaavemglkaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyyB (B:)
    dlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgira
    siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqal
    yraglngghnhgndwgsaavemglkal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kyyC (C:)
    mfsgikgpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvp
    gswelpqgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilg
    lltvlneeqalyraglngghnhgndwgsaavemglkaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyyC (C:)
    sdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgir
    asiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqa
    lyraglngghnhgndwgsaavemglkaly
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kyyD (D:)
    mfsgikgpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvp
    gswelpqgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilg
    lltvlneeqalyraglngghnhgndwgsaavemglkaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyyD (D:)
    dlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgira
    siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqal
    yraglngghnhgndwgsaavemglkal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kyyE (E:)
    mfsgikgpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvp
    gswelpqgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilg
    lltvlneeqalyraglngghnhgndwgsaavemglkaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyyE (E:)
    gpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelp
    qgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvln
    eeqalyraglngghnhgndwgsaavemglkal