PDB entry 1kyw

View 1kyw on RCSB PDB site
Description: Crystal Structure Analysis of Caffeic Acid/5-hydroxyferulic acid 3/5-O-methyltransferase in complex with 5-hydroxyconiferaldehyde
Class: transferase
Keywords: O-methyltransferase, lignification, protein-ligand complex
Deposited on 2002-02-06, released 2002-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.207
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caffeic acid 3-O-methyltransferase
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kywa1, d1kywa2
  • Chain 'C':
    Compound: Caffeic acid 3-O-methyltransferase
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kywc1, d1kywc2
  • Chain 'F':
    Compound: Caffeic acid 3-O-methyltransferase
    Species: Medicago sativa [TaxId:3879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kywf1, d1kywf2
  • Heterogens: SAH, HFL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kywA (A:)
    mgstgetqitpthisdeeanlfamqlasasvlpmilksaleldlleiiakagpgaqispi
    eiasqlpttnpdapvmldrmlrllacyiiltcsvrtqqdgkvqrlyglatvakylvkned
    gvsisalnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkgm
    sdhstitmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphviedap
    sypgvehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaecil
    pvapdsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyime
    flkkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kywA (A:)
    hisdeeanlfamqlasasvlpmilksaleldlleiiakagpgaqispieiasqlpttnpd
    apvmldrmlrllacyiiltcsvrtqqdgkvqrlyglatvakylvknedgvsisalnlmnq
    dkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkgmsdhstitmkkil
    etytgfeglkslvdvgggtgavintivskyptikginfdlphviedapsypgvehvggdm
    fvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaecilpvapdsslatkg
    vvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyimefl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kywC (C:)
    mgstgetqitpthisdeeanlfamqlasasvlpmilksaleldlleiiakagpgaqispi
    eiasqlpttnpdapvmldrmlrllacyiiltcsvrtqqdgkvqrlyglatvakylvkned
    gvsisalnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkgm
    sdhstitmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphviedap
    sypgvehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaecil
    pvapdsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyime
    flkkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kywC (C:)
    getqitpthisdeeanlfamqlasasvlpmilksaleldlleiiakagpgaqispieias
    qlpttnpdapvmldrmlrllacyiiltcsvrtqqdgkvqrlyglatvakylvknedgvsi
    salnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkgmsdhs
    titmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphviedapsypg
    vehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaecilpvap
    dsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyimeflkk
    v
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kywF (F:)
    mgstgetqitpthisdeeanlfamqlasasvlpmilksaleldlleiiakagpgaqispi
    eiasqlpttnpdapvmldrmlrllacyiiltcsvrtqqdgkvqrlyglatvakylvkned
    gvsisalnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkgm
    sdhstitmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphviedap
    sypgvehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaecil
    pvapdsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyime
    flkkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kywF (F:)
    getqitpthisdeeanlfamqlasasvlpmilksaleldlleiiakagpgaqispieias
    qlpttnpdapvmldrmlrllacyiiltcsvrtqqdgkvqrlyglatvakylvknedgvsi
    salnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkgmsdhs
    titmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphviedapsypg
    vehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaecilpvap
    dsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyimeflkk
    v