PDB entry 1kyt

View 1kyt on RCSB PDB site
Description: Crystal Structure of Thermoplasma acidophilum 0175 (APC014)
Class: structural genomics, unknown function
Keywords: structural genomics, putative hydrolase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2002-02-05, released 2003-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.224
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TA0175
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLQ2 (3-226)
      • cloning artifact (2)
      • modified residue (3)
      • engineered (14)
      • modified residue (72)
      • modified residue (95)
      • modified residue (101)
      • modified residue (147)
      • modified residue (163)
      • modified residue (181)
      • modified residue (183)
      • modified residue (226)
    Domains in SCOPe 2.06: d1kyta1, d1kyta2
  • Chain 'B':
    Compound: hypothetical protein TA0175
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0175
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HLQ2 (3-226)
      • cloning artifact (2)
      • modified residue (3)
      • engineered (14)
      • modified residue (72)
      • modified residue (95)
      • modified residue (101)
      • modified residue (147)
      • modified residue (163)
      • modified residue (181)
      • modified residue (183)
      • modified residue (226)
    Domains in SCOPe 2.06: d1kytb1, d1kytb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kytA (A:)
    gshmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflg
    ingpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdid
    pedvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnn
    dmpmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kytA (A:)
    hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin
    gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe
    dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm
    pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kytB (B:)
    gshmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflg
    ingpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdid
    pedvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnn
    dmpmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kytB (B:)
    hmirlaaidvdgnltdrdrlistkaiesirsaekkgltvsllsgnvipvvyalkiflgin
    gpvfgenggimfdndgsikkffsnegtnkfleemskrtsmrsiltnrwreastgfdidpe
    dvdyvrkeaesrgfvifysgyswhlmnrgedkafavnklkemysleydeilvigdsnndm
    pmfqlpvrkacpanatdnikavsdfvsdysygeeigqifkhfelm