PDB entry 1kyi

View 1kyi on RCSB PDB site
Description:
Deposited on 2002-02-04, released 2002-05-15
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-15, with a file datestamp of 2002-05-15.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.266
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyia_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyib_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyic_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyid_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyie_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyif_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyig_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyih_
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyii_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyij_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyik_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyil_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyim_
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyin_
  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyio_
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyip_
  • Chain 'Q':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyiq_
  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyir_
  • Chain 'S':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyis_
  • Chain 'T':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyit_
  • Chain 'U':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyiu_
  • Chain 'V':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyiv_
  • Chain 'W':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyiw_
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.61: d1kyix_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kyiA (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiA (A:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknaaklinpee
    lkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhi
    lfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmate
    gvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnida
    ayvadalgevvenedlsrfil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kyiB (B:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiB (B:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknaaklinpee
    lkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhi
    lfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmate
    gvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnida
    ayvadalgevvenedlsrfil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kyiC (C:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiC (C:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknaaklinpee
    lkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhi
    lfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmate
    gvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnida
    ayvadalgevvenedlsrfil
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kyiD (D:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiD (D:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknaaklinpee
    lkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhi
    lfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmate
    gvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnida
    ayvadalgevvenedlsrfil
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kyiE (E:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiE (E:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknaaklinpee
    lkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhi
    lfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmate
    gvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnida
    ayvadalgevvenedlsrfil
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kyiF (F:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiF (F:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevdsiirdltdsamklvrqqeiaknaaklinpee
    lkqkaidaveqngivfideidkickkgadvsregvqrdllplvegstvstkhgmvktdhi
    lfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmate
    gvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnida
    ayvadalgevvenedlsrfil
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiG (G:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiH (H:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiI (I:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiJ (J:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiK (K:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiL (L:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiM (M:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiN (N:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiO (O:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiP (P:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiQ (Q:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyiR (R:)
    ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf
    erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi
    laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelp
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1kyiS (S:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiS (S:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknrklinpeelkqka
    idaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfia
    sgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvni
    afttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayva
    dalgevvenedlsrfil
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1kyiT (T:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiT (T:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknrklinpeelkqka
    idaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfia
    sgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvni
    afttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayva
    dalgevvenedlsrfil
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1kyiU (U:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiU (U:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknrklinpeelkqka
    idaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfia
    sgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvni
    afttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayva
    dalgevvenedlsrfil
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1kyiV (V:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiV (V:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknrklinpeelkqka
    idaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfia
    sgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvni
    afttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayva
    dalgevvenedlsrfil
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1kyiW (W:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiW (W:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknrklinpeelkqka
    idaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfia
    sgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvni
    afttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayva
    dalgevvenedlsrfil
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1kyiX (X:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveatkftevgyvgkevdsiirdltdsamklvrqqeiaknra
    raedvaeerildallppaknqwgevenhdshsstrqafrkklregqlddkeieidvsagv
    smgveimappgmeemtnqlqslfqnlgsdktkkrkmkikdalkaliddeaaklinpeelk
    qkaidaveqngivfideidkickkgeysgadvsregvqrdllplvegstvstkhgmvktd
    hilfiasgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalma
    tegvniafttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvni
    daayvadalgevvenedlsrfil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyiX (X:)
    semtpreivseldqhiigqadakravaialrnrwrrmqlqeplrhevtpknilmigptgv
    gkteiarrlaklanapfikveaevdsiirdltdsamklvrqqeiaknrklinpeelkqka
    idaveqngivfideidkickksgadvsregvqrdllplvegstvstkhgmvktdhilfia
    sgafqvarpsdlipelqgrlpirveltalsaadferiltephaslteqykalmategvni
    afttdavkkiaeaafrvnektenigarrlhtvmerlmdkisfsasdmngqtvnidaayva
    dalgevvenedlsrfil