PDB entry 1kyh

View 1kyh on RCSB PDB site
Description: Structure of Bacillus subtilis YxkO, a Member of the UPF0031 Family and a Putative Kinase
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2002-02-04, released 2002-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical 29.9 kDa protein in SIGY-CYDD intergenic region
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YXKO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P94368 (Start-275)
      • modified residue (38)
      • modified residue (50)
      • modified residue (155)
      • modified residue (220)
      • modified residue (224)
    Domains in SCOPe 2.08: d1kyha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kyhA (A:)
    mnvpfwteehvratlperdaeshkgtygtalllagsddmpgaallaglgamrsglgklvi
    gtsenviplivpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvlt
    adcpvildagalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlq
    tvivlkgnqtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlnav
    ylhgacaelwtdehsahtllahelsdilprvwkrfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kyhA (A:)
    nvpfwteehvratlpertygtalllagsddmpgaallaglgamrsglgklvigtsenvip
    livpvlpeatywrdgwkkaadaqleetyraiaigpglpqtesvqqavdhvltadcpvild
    agalakrtypkregpviltphpgeffrmtgvpvnelqkkraeyakewaaqlqtvivlkgn
    qtviafpdgdcwlnptgngalakggtgdtltgmilgmlcchedpkhavlnavylhgacae
    lwtdehsahtllahelsdilprvwkrfe