PDB entry 1kyf

View 1kyf on RCSB PDB site
Description: ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide
Class: endocytosis/exocytosis
Keywords: protein-peptide complex, endocytosis, endocytosis-exocytosis complex
Deposited on 2002-02-04, released 2002-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-adaptin c
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17427 (9-246)
      • cloning artifact (0-8)
    Domains in SCOPe 2.08: d1kyfa1, d1kyfa2, d1kyfa3
  • Chain 'P':
    Compound: epidermal growth factor receptor substrate 15
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kyfA (A:)
gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln
ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf
qnvsvklpitlnkffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiig
fgsalleevdpnpanfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlc
ellseqf

  • Chain 'P':
    No sequence available.