PDB entry 1kya

View 1kya on RCSB PDB site
Description: active laccase from trametes versicolor complexed with 2,5-xylidine
Class: oxidoreductase
Keywords: blue-copper, oxidoreductase
Deposited on 2002-02-04, released 2002-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.253
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: laccase
    Species: Trametes versicolor [TaxId:5325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyaa1, d1kyaa2, d1kyaa3
  • Chain 'B':
    Compound: laccase
    Species: Trametes versicolor [TaxId:5325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyab1, d1kyab2, d1kyab3
  • Chain 'C':
    Compound: laccase
    Species: Trametes versicolor [TaxId:5325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyac1, d1kyac2, d1kyac3
  • Chain 'D':
    Compound: laccase
    Species: Trametes versicolor [TaxId:5325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kyad1, d1kyad2, d1kyad3
  • Heterogens: NAG, CU, PYE, XYD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyaA (A:)
    gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks
    tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl
    rgpfvvydpndpaadlydvdnddtvitlvdwyhvaaklgpafplgadatlingkgrspst
    ttadlsvisvtpgkryrfrlvslscdpnytfsidghnmtiietdsintaplvvdsiqifa
    aqrysfvleanqavdnywiranpnfgnvgftgginsailrydgaaaveptttqttstapl
    nevnlhplvatavpgspvaggvdlainmafnfngtnffingasftpptvpvllqiisgaq
    naqdllpsgsvyslpsnadieisfpataaapgaphpfhlhghafavvrsagstvynydnp
    ifrdvvstgtpaagdnvtirfrtdnpgpwflhchidfhleagfavvfaedipdvasanpv
    pqawsdlcptydardpsdq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyaB (B:)
    gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks
    tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl
    rgpfvvydpndpaadlydvdnddtvitlvdwyhvaaklgpafplgadatlingkgrspst
    ttadlsvisvtpgkryrfrlvslscdpnytfsidghnmtiietdsintaplvvdsiqifa
    aqrysfvleanqavdnywiranpnfgnvgftgginsailrydgaaaveptttqttstapl
    nevnlhplvatavpgspvaggvdlainmafnfngtnffingasftpptvpvllqiisgaq
    naqdllpsgsvyslpsnadieisfpataaapgaphpfhlhghafavvrsagstvynydnp
    ifrdvvstgtpaagdnvtirfrtdnpgpwflhchidfhleagfavvfaedipdvasanpv
    pqawsdlcptydardpsdq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyaC (C:)
    gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks
    tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl
    rgpfvvydpndpaadlydvdnddtvitlvdwyhvaaklgpafplgadatlingkgrspst
    ttadlsvisvtpgkryrfrlvslscdpnytfsidghnmtiietdsintaplvvdsiqifa
    aqrysfvleanqavdnywiranpnfgnvgftgginsailrydgaaaveptttqttstapl
    nevnlhplvatavpgspvaggvdlainmafnfngtnffingasftpptvpvllqiisgaq
    naqdllpsgsvyslpsnadieisfpataaapgaphpfhlhghafavvrsagstvynydnp
    ifrdvvstgtpaagdnvtirfrtdnpgpwflhchidfhleagfavvfaedipdvasanpv
    pqawsdlcptydardpsdq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kyaD (D:)
    gigpvadltitnaavspdgfsrqavvvnggtpgplitgnmgdrfqlnvidnltnhtmlks
    tsihwhgffqkgtnwadgpafinqcpissghsflydfqvpdqagtfwyhshlstqycdgl
    rgpfvvydpndpaadlydvdnddtvitlvdwyhvaaklgpafplgadatlingkgrspst
    ttadlsvisvtpgkryrfrlvslscdpnytfsidghnmtiietdsintaplvvdsiqifa
    aqrysfvleanqavdnywiranpnfgnvgftgginsailrydgaaaveptttqttstapl
    nevnlhplvatavpgspvaggvdlainmafnfngtnffingasftpptvpvllqiisgaq
    naqdllpsgsvyslpsnadieisfpataaapgaphpfhlhghafavvrsagstvynydnp
    ifrdvvstgtpaagdnvtirfrtdnpgpwflhchidfhleagfavvfaedipdvasanpv
    pqawsdlcptydardpsdq