PDB entry 1ky8

View 1ky8 on RCSB PDB site
Description: crystal structure of the non-phosphorylating glyceraldehyde-3- phosphate dehydrogenase
Deposited on 2002-02-04, released 2003-02-04
The last revision prior to the SCOP 1.69 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ky8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ky8A (A:)
    mragllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertl
    dvlfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaav
    drlrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkity
    sfiygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavs
    ftgstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdai
    klvlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekgg
    rvlaggrrlgptyvqptlveapadrvkdmvlykrevfapvasavevkdldqaielangrp
    ygldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyave
    avtayktivfnykgkgvwkye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky8A (A:)
    agllegvikekggvpvypsylagewggsgqeievkspidlatiakvispsreevertldv
    lfkrgrwsardmpgterlavlrkaadiiernldvfaevlvmnagkpksaavgevkaavdr
    lrlaeldlkkiggdyipgdwtydtleteglvrreplgvvaaitpfnyplfdavnkitysf
    iygnavvvkpsisdplpaamavkalldagfppdaiallnlpgkeaekivaddrvaavsft
    gstevgervvkvggvkqyvmelgggdpaivledadldlaadkiargiysyagqrcdaikl
    vlaerpvygklveevakrlsslrvgdprdptvdvgplispsavdemmaaiedavekggrv
    laggrrlgptyvqptlveapadrvkdmvlykrevfapvasavevkdldqaielangrpyg
    ldaavfgrdvvkirravrllevgaiyindmprhgigyypfggrkksgvfregigyaveav
    tayktivfnykgkgvwkye