PDB entry 1ky5

View 1ky5 on RCSB PDB site
Description: D244E mutant S-Adenosylhomocysteine hydrolase refined with noncrystallographic restraints
Class: hydrolase
Keywords: Hydrolase, S-adenosylhomocysteine
Deposited on 2002-02-03, released 2002-09-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760
      • engineered (243)
    Domains in SCOPe 2.05: d1ky5a1, d1ky5a2
  • Chain 'B':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760
      • engineered (243)
    Domains in SCOPe 2.05: d1ky5b1, d1ky5b2
  • Chain 'C':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760
      • engineered (243)
    Domains in SCOPe 2.05: d1ky5c1, d1ky5c2
  • Chain 'D':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10760 (Start-430)
      • engineered (243)
    Domains in SCOPe 2.05: d1ky5d1, d1ky5d2
  • Heterogens: NAI, ADY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ky5A (A:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky5A (A:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ky5B (B:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky5B (B:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ky5C (C:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky5C (C:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ky5D (D:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky5D (D:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry