PDB entry 1ky5

View 1ky5 on RCSB PDB site
Description:
Deposited on 2002-02-03, released 2002-09-25
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-25, with a file datestamp of 2002-09-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ky5a1, d1ky5a2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ky5b1, d1ky5b2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ky5c1, d1ky5c2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ky5d1, d1ky5d2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ky5A (A:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ky5B (B:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ky5C (C:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ky5D (D:)
    dklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetav
    lietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkd
    gplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvnd
    svtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviit
    eiepinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighf
    dveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsf
    tnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpin
    gpfkpdhyry