PDB entry 1ky4

View 1ky4 on RCSB PDB site
Description: S-Adenosylhomocysteine hydrolase refined with noncrystallographic restraints
Class: hydrolase
Keywords: hydrolase, S-adenosylhomocysteine
Deposited on 2002-02-03, released 2002-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.228
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ky4a1, d1ky4a2
  • Chain 'B':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ky4b1, d1ky4b2
  • Chain 'C':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ky4c1, d1ky4c2
  • Chain 'D':
    Compound: s-adenosylhomocysteine hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ky4d1, d1ky4d2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ky4A (A:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky4A (A:)
    lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
    etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
    lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpingp
    fkpdhyry
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ky4B (B:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky4B (B:)
    lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
    etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
    lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpingp
    fkpdhyry
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ky4C (C:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky4C (C:)
    lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
    etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
    lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpingp
    fkpdhyry
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ky4D (D:)
    adklpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtveta
    vlietlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfk
    dgplnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvn
    dsvtkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarvii
    teidpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnigh
    fdveidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsns
    ftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpi
    ngpfkpdhyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ky4D (D:)
    lpykvadiglaawgrkaldiaenempglmrmremysaskplkgariagclhmtvetavli
    etlvalgaevrwsscnifstqdhaaaaiakagipvfawkgetdeeylwcieqtlhfkdgp
    lnmilddggdltnlihtkhpqllsgirgiseetttgvhnlykmmangilkvpainvndsv
    tkskfdnlygcreslidgikratdvmiagkvavvagygdvgkgcaqalrgfgarviitei
    dpinalqaamegyevttmdeackegnifvtttgcvdiilgrhfeqmkddaivcnighfdv
    eidvkwlnenavekvnikpqvdryllknghriillaegrlvnlgcamghpsfvmsnsftn
    qvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvkltkltekqaqylgmpingp
    fkpdhyry