PDB entry 1kxv

View 1kxv on RCSB PDB site
Description:
Deposited on 2002-02-01, released 2002-06-19
The last revision prior to the SCOP 1.65 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.205
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxva1, d1kxva2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxvb1, d1kxvb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxvc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1kxvd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxvA (A:)
    qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxvB (B:)
    qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kxvC (C:)
    qvqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyv
    dsvagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxvC (C:)
    vqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyvd
    svagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxvD (D:)
    qvqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyv
    dsvagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs
    s