PDB entry 1kxv

View 1kxv on RCSB PDB site
Description: Camelid VHH Domains in Complex with Porcine Pancreatic alpha-Amylase
Class: hydrolase, immune system
Keywords: beta 8 alpha 8, beta barrel, hydrolase, immune system
Deposited on 2002-02-01, released 2002-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.205
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase, pancreatic
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00690 (0-495)
      • see remark 999 (242)
      • see remark 999 (309)
      • see remark 999 (322)
      • see remark 999 (403)
    Domains in SCOPe 2.06: d1kxva1, d1kxva2
  • Chain 'B':
    Compound: alpha-amylase, pancreatic
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00690 (0-495)
      • see remark 999 (242)
      • see remark 999 (309)
      • see remark 999 (322)
      • see remark 999 (403)
    Domains in SCOPe 2.06: d1kxvb1, d1kxvb2
  • Chain 'C':
    Compound: camelid vhh domain cab10
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KXV
    Domains in SCOPe 2.06: d1kxvc_
  • Chain 'D':
    Compound: camelid vhh domain cab10
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 1KXV (0-120)
    Domains in SCOPe 2.06: d1kxvd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxvA (A:)
    qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxvB (B:)
    qyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
    ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
    pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
    dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
    aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
    pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdgqpfanwwdngsnqvafg
    rgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvyvssdgtaqfsis
    nsaedpfiaihaeskl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kxvC (C:)
    qvqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyv
    dsvagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxvC (C:)
    vqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyvd
    svagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxvD (D:)
    qvqlvesgggtvpaggslrlscaasgntlctydmswyrrapgkgrdfvsgidndgtttyv
    dsvagrftisqgnakntaylqmdslkpddtamyyckpslryglpgcpiipwgqgtqvtvs
    s