PDB entry 1kxu

View 1kxu on RCSB PDB site
Description: cyclin h, a positive regulatory subunit of cdk activating kinase
Class: regulatory protein
Keywords: regulatory protein, cyclin, cell cycle, cell division, nuclear protein, alpha-helical structure
Deposited on 1996-08-08, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin h
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kxua1, d1kxua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kxuA (A:)
    mshhhhhhgsmyhnssqkrhwtfsseeqlarlradanrkfrckavangkvlpndpvflep
    heemtlckyyekrllefcsvfkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaf
    lackvdefnvsspqfvgnlresplgqekaleqileyellliqqlnfhlivhnpyrpfegf
    lidlktrypilenpeilrktaddflnrialtdayllytpsqialtailssasragitmes
    ylseslmlkenrtclsqlldimksmrnlvkkyepprseevavlkqklerchsaelalnvi
    tkkrkgyedddyvskkskheeeewtdddlvesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kxuA (A:)
    wtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyyekrllefcsv
    fkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvsspqfvgnlr
    esplgqekaleqileyellliqqlnfhlivhnpyrpfegflidlktrypilenpeilrkt
    addflnrialtdayllytpsqialtailssasragitmesylseslmlkenrtclsqlld
    imksmrnlvkkyepprseevavlkqklerchsaela