PDB entry 1kxu

View 1kxu on RCSB PDB site
Description: cyclin h, a positive regulatory subunit of cdk activating kinase
Deposited on 1996-08-08, released 1997-01-27
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-27, with a file datestamp of 1997-01-27.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.214
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kxu_ (-)
    wtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyyekrllefcsv
    fkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvsspqfvgnlr
    esplgqekaleqileyellliqqlnfhlivhnpyrpfegflidlktrypilenpeilrkt
    addflnrialtdayllytpsqialtailssasragitmesylseslmlkenrtclsqlld
    imksmrnlvkkyepprseevavlkqklerchsaela